PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000058G1000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SRS
Protein Properties Length: 134aa    MW: 13798.1 Da    PI: 4.7557
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000058G1000genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702843.6e-261263103154
           DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      +slP++v+++avf+cvrv+s+ddge+e+aYq+ v+i+GhvfkG+LydqG+++
  PH01000058G1000  12 ESLPRHVRAPAVFKCVRVTSIDDGEDEYAYQAMVTINGHVFKGFLYDQGIDD 63 
                      67***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.2E-231162IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016242.2E-281461IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MATYYVYASF RESLPRHVRA PAVFKCVRVT SIDDGEDEYA YQAMVTINGH VFKGFLYDQG  60
IDDGRLAATS NDDSTAGVPN ISELHLGGAS VSGPGGNAVR EGGSSMLPSD LYGGSGGGGP  120
HVLGGSSYGN TMN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126091e-100CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015691020.11e-66PREDICTED: protein LATERAL ROOT PRIMORDIUM 1, partial
SwissprotQ94CK93e-25LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A0D3EYS82e-64A0A0D3EYS8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0N7R32e-64A0A0E0N7R3_ORYRU; Uncharacterized protein
TrEMBLI1NVC02e-64I1NVC0_ORYGL; Uncharacterized protein
STRINGORGLA01G0381000.16e-64(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35793679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.29e-27Lateral root primordium (LRP) protein-related